Toward global integration of biodiversity big data: a harmonized metabarcode data generation module for terrestrial arthropods

Metazoan metabarcoding is emerging as an essential strategy for inventorying biodiversity,with diverse projects currently generating massive quantities of community-level data. The potential for integrating across such data sets offers new opportunities to better understand biodiversity and how it might respond to global change. However, large-scale synthesesmay be compromised if metabarcoding workflows differ from each other. There are ongoing efforts to improve standardization for the reporting of inventory data. However, harmonization at the stage of generating metabarcode data has yet to be addressed. A modular framework for harmonized data generation offers a pathway to navigate the complex structure of terrestrial metazoan biodiversity. Here, through our collective expertise as practitioners,method developers, and researchers leading metabarcoding initiatives to inventory terrestrial biodiversity, we seek to initiate a harmonized framework for metabarcode data generation, with a terrestrial arthropod module. We develop an initial set of submodules covering the 5 main steps of metabarcode data generation: (i) sample acquisition; (ii) sample processing; (iii) DNA extraction; (iv) polymerase chain reaction amplification, library preparation, and sequencing; and (v) DNA sequence and metadata deposition, providing a backbone for a terrestrial arthropod module. To achieve this, we (i) identified key points for harmonization, (ii) reviewed the current state of the art, and (iii) distilled existing knowledge within submodules, thus promoting best practice by providing guidelines and recommendations to reduce the universe of methodological options.We advocate the adoption and further development of the terrestrial arthropodmodule.We further encourage the development of modules for other biodiversity fractions as an essential step toward large-scale biodiversity synthesis through harmonization.

Arribas, Paula; Andújar, Carmelo; Bohmann, Kristine; deWaard, Jeremy R.; Economo, Evan P.; Elbrecht, Vasco; Geisen, Stefan; Goberna, Marta; Krehenwinkel, Henrik; Novotny, Vojtech; Zinger, Lucie; Creedy, Thomas J.; Meramveliotakis, Emmanouil; Noguerales, Víctor; Overcast, Isaac; Morlon, Hélène; Papadopoulou, Anna; Vogler, Alfried P.; Emerson, Brent C.

Giga Science, 11: 1-12 (2022)
DOIDigital.CSIC

Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis

The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development.

Otazo-Pérez, Andrea; Asensio-Calavia, Patricia; González-Acosta, Sergio; Baca-González, Victoria; López, Manuel R; Morales-De la Nuez, Antonio; Pérez de la Lastra, José Manuel.

Vaccines 10(7): 1105(2022)
DOIDigital.CSIC

Cellular landscaping of cisplatin resistance in cervical cancer

Cervical cancer (CC) caused by human papillomavirus (HPV) is one of the largest causes of malignancies in women worldwide. Cisplatin is one of the widely used drugs for the treatment of CC is rendered ineffective owing to drug resistance. This review highlights the cause of resistance and the mechanism of cisplatin resistance cells in CC to develop therapeutic ventures and strategies that could be utilized to overcome the aforementioned issue. These strategies would include the application of nanocarries, miRNA, CRIPSR/Cas system, and chemotherapeutics in synergy with cisplatin to not only overcome the issues of drug resistance but also enhance its anti-cancer efficiency. Moreover, we have also discussed the signaling network of cisplatin resistance cells in CC that would provide insights to develop therapeutic target sites and inhibitors. Furthermore, we have discussed the role of CC metabolism on cisplatin resistance cells and the physical and biological factors affecting the tumor microenvironments.

Bhattacharjeea, Rahul; Deya, Tanima; Kumar, Lamha; Kar, Sulagna; Sarkar, Ritayan; Ghorai, Mimosa; Malik, Sumira; Kumar Jha, Niraj; Vellingiri, Balachandar; Kumar Kesari, Kavindra; Pérez de Lastra, José Manuel; Dey, Abhijit.

Biomedicine and Pharmacotherapy, 153, 113345: 1-18 (2022)
DOIDigital.CSIC

Antifungal and Herbicidal Potential of Piper Essential Oils from the Peruvian Amazonia

The chemical composition of essential oils (EOs) from ten Peruvian Piper species (Piper coruscans, Pc; P. tuberculatum, Pt; P. casapiense, Pcs; P. obliquum, Po; P. dumosum, Pd; P. anonifolium, Pa; P. reticulatum, Pr; P. soledadense, Ps; P. sancti-felicis, Psf and P. mituense, Pm) has been studied, along with their antifungal and phytotoxic activities. These EOs contained β-bisabolene/nerolidol (Pc), β-bisabolene/δ-cadinene/caryophyllene (Pt), caryophyllene oxide (Pcs), bicyclogermacrene/10-epi-Elemol (Po), bicyclogermacrene/germacrene-D/apiol (Pd), caryophyllene/germacrene-D (Pa), germacrene-D (Pr), limonene/apiol (Ps), apiol (Psf), and apiol/bicyclogermacrene (Pm) as major components, and some are described here for the first time (Ps, Pcs, Pm). A composition-based dendrogram of these Piper species showed four major groups (G1: Pc and Pt, G2: Pcs, Po, Pd, Pa, and Pr, G3: Ps, and G4: Psf and Pm). The spore germination effects (Aspergillus niger, Botrytis cinerea, and Alternaria alternate) and phytotoxicity (Lolium perenne and Lactuca sativa) of these EOs were studied. Most of these Piper essential oils showed important activity against phytopathogenic fungi (except G1), especially against B. cinerea. Similarly, most of the essential oils were phytotoxic against L. perenne (except G1), with P. sancti-felicis (G4), P. casapiense (G2), and P. reticulatum (G2) being the most effective. Caryophyllene oxide, β-caryophyllene, β-pinene, limonene, α-humulene, and apiol were evaluated against B. cinerea, with the most effective compounds being β-pinene, apiol, and limonene. This work demonstrates the species-dependent potential of essential oils from Peruvian Piper species as fungicidal and herbicidal agents.

Ruiz-Vásquez, Liliana; Ruiz Mesia, Lastenia; Caballero Ceferino, Henry Denny; Ruiz Mesia, Wilfredo; Andrés, Maria Fe; Díaz, Carmen E.; Gonzalez-Coloma, Azucena.

Plants 11(14), 1793: 1-13 (2022)
DOIDigital.CSIC

Host-Defense Peptides as New Generation Phytosanitaries: Low Toxicity and Low Induction of Antimicrobial Resistance

Host-defense peptides (HDP) are emerging as promising phytosanitaries due to their potency, low plant, animal and environmental toxicity, and above all, low induction of antimicrobial resistance. These natural compounds, which have been used by animals and plants over millions of years to defend themselves against pathogens, are being discovered by genome mining, and then produced using biofactories. Moreover, truncated or otherwise modified peptides, including ultra-short ones, have been developed to improve their bioactivities and biodistribution, and also to reduce production costs. The synergistic combination of HDP and other antimicrobials, and the development of hybrid molecules have also given promising results. Finally, although their low induction of antimicrobial resistance is a big advantage, cautionary measures for the sustainable use of HDPs, such as the use of precision agriculture tools, were discussed.

Lobo, Fernando; Boto, Alicia.

Agronomy, 12(7), 1614: 1-12 (2022)
DOIDigital.CSIC

Rock Magnetism of Lapilli and Lava Flows from Cumbre Vieja Volcano, 2021 Eruption (La Palma, Canary Islands): Initial Reports

We present initial rock magnetic results for both lava flows and lapilli produced by the 2021 eruption of the Cumbre Vieja, La Palma (Canary Islands). Samples were taken during the eruption to minimize early alteration and weathering of the rocks and tephra. Standard procedures included progressive alternating field and thermal demagnetization, hysteresis curves, thermomagnetic experiments, progressive acquisition of isothermal remanent magnetization (IRM), and First-Order Reversal Curves (FORCs). Overall, our observations, including low to medium unblocking temperatures, isothermal remanent magnetization to 1 Tesla, and the abundance of wasp-waist hysteresis loops, strongly suggest the presence of Ti-rich titanomagnetites as the main remanence carriers in both lava flows and lapilli, in addition to some hematite as well. Whereas the former has been directly seen (SEM), hematite is elusive with nonmagnetic-based methods. Rock magnetic data, on a Day plot, also reveal that the magnetic grain size tends to be larger in the lava flows than in the lapilli.

Parés, Josep M.; Vernet, Eva; Calvo-Rathert, Manuel; Soler, Vicente; Bógalo, María Felicidad; Álvaro, Ana.

Geosciences, 12(7), 271: 1-15 (2022)
DOIDigital.CSIC

Nuevos datos de distribución de insectos (Diptera e Hymenoptera) en las Islas Canarias

Aportamos 25 primeras citas de distribución insular de insectos (19 correspondientes a dípteros y 6 a himenópteros) de las islas de Lanzarote, Fuerteventura, La Gomera, La Palma y El Hierro (Islas Canarias, España). Destacan primeros registros de especies endémicas hasta este momento monoinsulares como Nemotelus insularis y registros de especies exóticas como Copestylum melleum. Estos resultados ponen de manifiesto la importancia de la realización de estudios faunísticos y corológicos en las islas, ya que aportan información vital para mejorar el conocimiento de la fauna, tanto exótica como nativa, lo que ayuda a desarrollar medidas de gestión y conservación más eficaces.

Lugo, David; Suárez, Daniel; Pérez-Delgado, Antonio José; García, Javier; Hernández-Teixidor, David.

Boletín de la Sociedad Entomológica Aragonesa, 70: 36-40 (2022)
Digital.CSIC

Nuevos datos de distribución de insectos para Canarias (Blattodea, Coleoptera y Hemiptera)

Lugo, David; Suárez. Daniel; Pérez-Delgado, Antonio José; García, Javier; Hernández-Teixidor, David.

Boletín de la Asociación Española de Entomología, 46(1-2): 175-179 (2022)
Digital.CSIC

Differences in the levels of sulphites and pesticide residues in soils and wines and under organic and conventional production methods

The surface and output of organic agriculture is growing steadily in recent years, being generally seen as a healthier, safer and more sustainable alternative to conventional agriculture. Comparisons between organic and conventional products are nonetheless scarce in the literature, especially in the case of wine. The aim of this study was to compare sulphite content and pesticide residues in both soils and wines under organic and conventional production. Fourteen samples of organic and conventional wines and vineyard soils were collected in pairs for each of the seven wine-producing islands of the Canary Islands. A QuEChERS-based method was employed to detect 218 pesticides and 49 POPs. Sulphites were measured by potentiometric titration with a double electrode. On average, higher levels of sulphites were found in conventional wines. Similarly, conventional wines presented higher numbers and concentrations of pesticide residues both in soils and wines than their organic counterparts. The overall pesticide concentrations in our sample was 4.2 µg/kg. Conventional wines presented a considerably higher average concentration than organic wines (8.2 against 0.25 µg/kg). In turn, concentrations in conventional soils averaged 8.7 against 2.8 µg/kg in organic soils, a 68.19 % lower residue concentration. The analytes most commonly found were PCB 28, p,p′-DDE, tebuconazole and the metabolite 4,4′-dichlorobenzophenone in soils and mefenoxam, tebuconazole, fluopyram and boscalid in wines. No single wine exceeded the 10 % of the MRLs established by the European Union for wine grapes. However, the presence of low levels of pesticides in organic wines should be monitored.

Alonso-González, Pablo; Parga-Dans, Eva ; Acosta Dacal, Andrea Carolina; Zumbado Peña, Manuel; Pérez Luzardo, Octavio.

Journal of Food Composition and Analysis, 112, 104714 : 1-8 (2022)
DOIDigital.CSIC

The 2021 eruption of the Cumbre Vieja volcanic ridge on La Palma, Canary Islands

Almost exactly half a century after the eruption of the Teneguía Volcano on La Palma (26 October to 28 November 1971), a new eruption occurred on the island and lasted for 85 days from 19 September until 13 December 2021. This new eruption opened a volcanic vent complex on the western flank of the Cumbre Vieja rift zone, the N-S elongated polygenetic volcanic ridge that has developed on La Palma over the last c. 125 ka. The Cumbre Vieja ridge is the volcanically active region of the island and the most active one of the Canary Islands, hosting half of all the historically recorded eruptive events in the archipelago. The 2021 La Palma eruption has seen no direct loss of human life, thanks to efficient early detection and sensible management of the volcanic crisis by the authorities, but more than 2800 buildings and almost 1000 hectares of plantations and farmland were affected by lava flows and pyroclastic deposits. Satellite surveillance enabled accurate mapping of the progressive buildup of the extensive and complex basaltic lava field, which together with monitoring of gas emissions informed the timely evacuation of local populations from affected areas. Lava flows that reached the sea constructed an extensive system of lava deltas and platforms, similar to events during earlier historical eruptions such as in 1712, 1949 and 1971. Long-term challenges in the aftermath of the eruption include protection of drainage systems from potential redistribution of tephra during high rainfall events, the use of the large surplus quantities of ash in reconstruction of buildings and in agriculture, and the crucial concerns of where and how rebuilding should and could occur in the aftermath of the eruption. Finally, there remain strong financial concerns over insurance for properties consumed or damaged by the eruption in the light of future volcanic hazards from the Cumbre Vieja volcanic ridge.

Carracedo, Juan C.; Troll, Valentin R.; Day, James M. D.; Geiger, Harri; Aulinas, Meritxell; Soler, Vicente; Deegan, Frances M.; Perez-Torrado, Francisco J.; Gisbert, Guillem; Gazel, Esteban; Rodríguez-González, Alejandro; Albert, Helena.

Geology Today, 38(3), 94-107 (2022)
DOIDigital.CSIC